PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g42936.1.p
Common NameBRADI_2g42936
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 163aa    MW: 18557.4 Da    PI: 11.842
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g42936.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29e-141155348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       WT+eEd +l ++ ++   ++W+++ar m+ gR+ k c++rw+++l
  Bradi2g42936.1.p 11 GWTAEEDARLEKLATENRFRHWHRVARQMP-GRSHKLCRDRWRDHL 55
                      6*****************************.************986 PP

2Myb_DNA-binding30.11.1e-0963105347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++T+ +d  l++ ++++Gg+ Wk I+r++   Rt   +k rw  +
  Bradi2g42936.1.p  63 AFTAADDAELARQHRRHGGR-WKDISRHVH-ARTTRVLKRRWKEL 105
                       79******************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.196559IPR017930Myb domain
SMARTSM007176.7E-8857IPR001005SANT/Myb domain
SuperFamilySSF466896.88E-198102IPR009057Homeodomain-like
PfamPF002492.3E-111155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-171265IPR009057Homeodomain-like
CDDcd001673.63E-91255No hitNo description
SMARTSM007171.7E-660108IPR001005SANT/Myb domain
PROSITE profilePS5129410.5662110IPR017930Myb domain
CDDcd001671.64E-563106No hitNo description
PfamPF139211.5E-764108No hitNo description
Gene3DG3DSA:1.10.10.602.6E-1066109IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MLIVRLRLRR GWTAEEDARL EKLATENRFR HWHRVARQMP GRSHKLCRDR WRDHLARDLY  60
SRAFTAADDA ELARQHRRHG GRWKDISRHV HARTTRVLKR RWKELLRKKN GAEKMEASTS  120
PTLQHPLADV LAAGLSSCSL GGGPAGDPRL GSLALGFACM AV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-15121097104C-Myb DNA-Binding Domain
1mse_C3e-15121097104C-Myb DNA-Binding Domain
1gv2_A4e-15121097104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195100RVLKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645964.17e-52PREDICTED: myb-related protein B-like
TrEMBLA0A0Q3J7Z21e-114A0A0Q3J7Z2_BRADI; Uncharacterized protein
STRINGBGIOSGA024398-PA2e-51(Oryza sativa Indica Group)
STRINGLOC_Os07g25370.12e-51(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125692035
Representative plantOGRP10428310
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-17myb domain protein 73